SCOP 1.73: Domain d1wz7c1: 1wz7 C:1-98

Lineage for d1wz7c1 (1wz7 C:1-98)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.330: ERH-like [143874] (1 superfamily)
   beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10

4. Superfamily d.330.1: ERH-like [143875] (1 family)

5. Family d.330.1.1: ERH-like [143876] (1 protein)
   Pfam PF01133

6. Protein Enhancer of rudimentary homolog, ERH [143877] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [143878] (4 PDB entries)
   also includes 100% identical human protein P84090 (1W9G)

8. Domain d1wz7c1: 1wz7 C:1-98 [121482]
   automatically matched to 1WWQ A:8-111

Details for d1wz7c1

PDB Entry: 1wz7, 2.1 Å

PDB Description: Crystal structure of enhancer of rudimentary homologue (ERH)

PDB Compounds: (C:) Enhancer of rudimentary homolog

SCOP Domain Sequences for d1wz7c1:

Sequence, based on SEQRES records:

>d1wz7c1 d.330.1.1 (C:1-98) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
iddladlsclvyradtqtyqpynkdwikekiyvllrrq

Sequence, based on observed residues (ATOM records):

>d1wz7c1 d.330.1.1 (C:1-98) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpsitydisqlfdfidd
ladlsclvyradtqtyqpynkdwikekiyvllrrq

Timeline for d1wz7c1:

• d1wz7c1 is new in SCOP 1.73
  
• d1wz7c1 appears in SCOP 1.75
  
• d1wz7c1 appears in the current release, SCOPe 2.08, called d1wz7c_