SCOPe 2.08: Domain d1wz7c_: 1wz7 C:

Lineage for d1wz7c_ (1wz7 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.330: ERH-like [143874] (1 superfamily)
   beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10

4. Superfamily d.330.1: ERH-like [143875] (2 families)
   automatically mapped to Pfam PF01133

5. Family d.330.1.1: ERH-like [143876] (2 proteins)
   Pfam PF01133

6. Protein automated matches [190820] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188104] (1 PDB entry)

8. Domain d1wz7c_: 1wz7 C: [121482]
   Other proteins in same PDB: d1wz7a3
   automated match to d1wwqa1

Details for d1wz7c_

PDB Entry: 1wz7, 2.1 Å

PDB Description: Crystal structure of enhancer of rudimentary homologue (ERH)

PDB Compounds: (C:) Enhancer of rudimentary homolog

SCOPe Domain Sequences for d1wz7c_:

Sequence, based on SEQRES records:

>d1wz7c_ d.330.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
iddladlsclvyradtqtyqpynkdwikekiyvllrrq

Sequence, based on observed residues (ATOM records):

>d1wz7c_ d.330.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpsitydisqlfdfidd
ladlsclvyradtqtyqpynkdwikekiyvllrrq

Timeline for d1wz7c_:

• d1wz7c_ first appeared in SCOP 1.73, called d1wz7c1
  
• d1wz7c_ appears in SCOPe 2.07