![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.330: ERH-like [143874] (1 superfamily) beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10 |
![]() | Superfamily d.330.1: ERH-like [143875] (2 families) ![]() automatically mapped to Pfam PF01133 |
![]() | Family d.330.1.1: ERH-like [143876] (2 proteins) Pfam PF01133 |
![]() | Protein automated matches [190820] (1 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188104] (1 PDB entry) |
![]() | Domain d1wz7a2: 1wz7 A:1-100 [121480] Other proteins in same PDB: d1wz7a3 automated match to d1wwqa1 |
PDB Entry: 1wz7 (more details), 2.1 Å
SCOPe Domain Sequences for d1wz7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wz7a2 d.330.1.1 (A:1-100) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf iddladlsclvyradtqtyqpynkdwikekiyvllrrqaq
Timeline for d1wz7a2: