Lineage for d1wz1h_ (1wz1 H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (19 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (143 PDB entries)
  8. 2020223Domain d1wz1h_: 1wz1 H: [121476]
    Other proteins in same PDB: d1wz1l_
    automated match to d1dlfh_
    complexed with dns

Details for d1wz1h_

PDB Entry: 1wz1 (more details), 1.85 Å

PDB Description: Crystal structure of the Fv fragment complexed with dansyl-lysine
PDB Compounds: (H:) Ig heavy chain

SCOPe Domain Sequences for d1wz1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wz1h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
aep

SCOPe Domain Coordinates for d1wz1h_:

Click to download the PDB-style file with coordinates for d1wz1h_.
(The format of our PDB-style files is described here.)

Timeline for d1wz1h_: