Lineage for d1wz0a1 (1wz0 A:8-100)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1017617Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1017732Protein SUMO-2 [117816] (1 species)
  7. 1017733Species Human (Homo sapiens) [TaxId:9606] [117817] (9 PDB entries)
    Uniprot P61956
  8. 1017741Domain d1wz0a1: 1wz0 A:8-100 [121475]

Details for d1wz0a1

PDB Entry: 1wz0 (more details)

PDB Description: solution structure of human sumo-2 (smt3b), a ubiquitin-like protein
PDB Compounds: (A:) Ubiquitin-like protein SMT3B

SCOPe Domain Sequences for d1wz0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wz0a1 d.15.1.1 (A:8-100) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
rfdgqpinetdtpaqlemededtidvfqqqtsg

SCOPe Domain Coordinates for d1wz0a1:

Click to download the PDB-style file with coordinates for d1wz0a1.
(The format of our PDB-style files is described here.)

Timeline for d1wz0a1: