Lineage for d1wyzd2 (1wyz D:2-234)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519171Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2519172Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2519173Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2519384Protein automated matches [190790] (4 species)
    not a true protein
  7. 2519385Species Bacteroides thetaiotaomicron [TaxId:226186] [188101] (1 PDB entry)
  8. 2519388Domain d1wyzd2: 1wyz D:2-234 [121474]
    Other proteins in same PDB: d1wyza1, d1wyzb3, d1wyzc3, d1wyzd3
    automated match to d1wyza1

Details for d1wyzd2

PDB Entry: 1wyz (more details), 2.5 Å

PDB Description: x-ray structure of the putative methyltransferase from bacteroides thetaiotaomicron vpi-5482 at the resolution 2.5 a. norteast structural genomics consortium target btr28
PDB Compounds: (D:) putative S-adenosylmethionine-dependent methyltransferase

SCOPe Domain Sequences for d1wyzd2:

Sequence, based on SEQRES records: (download)

>d1wyzd2 c.90.1.1 (D:2-234) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvgp
ssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkm
iedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk

Sequence, based on observed residues (ATOM records): (download)

>d1wyzd2 c.90.1.1 (D:2-234) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv
masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn
crpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk

SCOPe Domain Coordinates for d1wyzd2:

Click to download the PDB-style file with coordinates for d1wyzd2.
(The format of our PDB-style files is described here.)

Timeline for d1wyzd2: