SCOPe 2.01: Domain d1wyzd_: 1wyz D:

Lineage for d1wyzd_ (1wyz D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein automated matches [190790] (3 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [188101] (1 PDB entry)

8. Domain d1wyzd_: 1wyz D: [121474]
   Other proteins in same PDB: d1wyza1
   automated match to d1wyza1

Details for d1wyzd_

PDB Entry: 1wyz, 2.5 Å

PDB Description: x-ray structure of the putative methyltransferase from bacteroides thetaiotaomicron vpi-5482 at the resolution 2.5 a. norteast structural genomics consortium target btr28

PDB Compounds: (D:) putative S-adenosylmethionine-dependent methyltransferase

SCOPe Domain Sequences for d1wyzd_:

Sequence, based on SEQRES records:

>d1wyzd_ c.90.1.1 (D:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvgp
ssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkm
iedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllykl

Sequence, based on observed residues (ATOM records):

>d1wyzd_ c.90.1.1 (D:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv
masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn
crpqtklciaanitcegefiqtrtvkdwkghipelskipcifllykl

Timeline for d1wyzd_:

• d1wyzd_ first appeared in SCOP 1.73, called d1wyzd1
  
• d1wyzd_ was called d1wyzd1 in SCOP 1.75
  
• d1wyzd_ appears in SCOPe 2.02
  
• d1wyzd_ appears in the current release, SCOPe 2.08, called d1wyzd2