Lineage for d1wyzd1 (1wyz D:2-234)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710141Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 710142Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family) (S)
  5. 710143Family c.90.1.1: Tetrapyrrole methylase [53791] (7 proteins)
    Pfam PF00590
  6. 710171Protein Putative methytransferase BT4190 [142783] (1 species)
  7. 710172Species Bacteroides thetaiotaomicron [TaxId:818] [142784] (1 PDB entry)
  8. 710176Domain d1wyzd1: 1wyz D:2-234 [121474]
    automatically matched to 1WYZ A:2-234

Details for d1wyzd1

PDB Entry: 1wyz (more details), 2.5 Å

PDB Description: x-ray structure of the putative methyltransferase from bacteroides thetaiotaomicron vpi-5482 at the resolution 2.5 a. norteast structural genomics consortium target btr28
PDB Compounds: (D:) putative S-adenosylmethionine-dependent methytransferase

SCOP Domain Sequences for d1wyzd1:

Sequence, based on SEQRES records: (download)

>d1wyzd1 c.90.1.1 (D:2-234) Putative methytransferase BT4190 {Bacteroides thetaiotaomicron [TaxId: 818]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvgp
ssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkm
iedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk

Sequence, based on observed residues (ATOM records): (download)

>d1wyzd1 c.90.1.1 (D:2-234) Putative methytransferase BT4190 {Bacteroides thetaiotaomicron [TaxId: 818]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv
masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn
crpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk

SCOP Domain Coordinates for d1wyzd1:

Click to download the PDB-style file with coordinates for d1wyzd1.
(The format of our PDB-style files is described here.)

Timeline for d1wyzd1: