SCOPe 2.06: Domain d1wyzc2: 1wyz C:2-234

Lineage for d1wyzc2 (1wyz C:2-234)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein automated matches [190790] (3 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [188101] (1 PDB entry)

8. Domain d1wyzc2: 1wyz C:2-234 [121473]
   Other proteins in same PDB: d1wyza1, d1wyzb3, d1wyzc3, d1wyzd3
   automated match to d1wyza1

Details for d1wyzc2

PDB Entry: 1wyz, 2.5 Å

PDB Description: x-ray structure of the putative methyltransferase from bacteroides thetaiotaomicron vpi-5482 at the resolution 2.5 a. norteast structural genomics consortium target btr28

PDB Compounds: (C:) putative S-adenosylmethionine-dependent methyltransferase

SCOPe Domain Sequences for d1wyzc2:

Sequence, based on SEQRES records:

>d1wyzc2 c.90.1.1 (C:2-234) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvgp
ssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkm
iedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk

Sequence, based on observed residues (ATOM records):

>d1wyzc2 c.90.1.1 (C:2-234) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsvmasg
fngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqncrpq
tklciaanitcegefiqtrtvkdwkghipelskipcifllyk

Timeline for d1wyzc2:

• d1wyzc2 first appeared in SCOP 1.73, called d1wyzc1
  
• d1wyzc2 was called d1wyzc_ in SCOPe 2.05
  
• d1wyzc2 appears in SCOPe 2.07
  
• d1wyzc2 appears in the current release, SCOPe 2.08