![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
![]() | Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) ![]() |
![]() | Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
![]() | Protein automated matches [190790] (4 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [188101] (1 PDB entry) |
![]() | Domain d1wyzb2: 1wyz B:2-234 [121472] Other proteins in same PDB: d1wyza1, d1wyzb3, d1wyzc3, d1wyzd3 automated match to d1wyza1 |
PDB Entry: 1wyz (more details), 2.5 Å
SCOPe Domain Sequences for d1wyzb2:
Sequence, based on SEQRES records: (download)
>d1wyzb2 c.90.1.1 (B:2-234) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf yplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvgp ssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkm iedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk
>d1wyzb2 c.90.1.1 (B:2-234) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn crpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk
Timeline for d1wyzb2: