Lineage for d1wyzb2 (1wyz B:2-234)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142835Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2142836Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2142837Family c.90.1.1: Tetrapyrrole methylase [53791] (8 protein domains)
    Pfam PF00590
  6. 2143041Protein automated matches [190790] (3 species)
    not a true protein
  7. 2143042Species Bacteroides thetaiotaomicron [TaxId:226186] [188101] (1 PDB entry)
  8. 2143043Domain d1wyzb2: 1wyz B:2-234 [121472]
    Other proteins in same PDB: d1wyza1, d1wyzb3, d1wyzc3, d1wyzd3
    automated match to d1wyza1

Details for d1wyzb2

PDB Entry: 1wyz (more details), 2.5 Å

PDB Description: X-Ray structure of the putative methyltransferase from Bacteroides thetaiotaomicron VPI-5482 at the resolution 2.5 A. Norteast Structural Genomics Consortium target Btr28
PDB Compounds: (B:) putative S-adenosylmethionine-dependent methyltransferase

SCOPe Domain Sequences for d1wyzb2:

Sequence, based on SEQRES records: (download)

>d1wyzb2 c.90.1.1 (B:2-234) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvgp
ssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkm
iedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk

Sequence, based on observed residues (ATOM records): (download)

>d1wyzb2 c.90.1.1 (B:2-234) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv
masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn
crpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk

SCOPe Domain Coordinates for d1wyzb2:

Click to download the PDB-style file with coordinates for d1wyzb2.
(The format of our PDB-style files is described here.)

Timeline for d1wyzb2: