Lineage for d1wyza1 (1wyz A:2-234)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1877645Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 1877646Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 1877647Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 1877824Protein Putative methytransferase BT4190 [142783] (1 species)
  7. 1877825Species Bacteroides thetaiotaomicron [TaxId:818] [142784] (1 PDB entry)
    Uniprot Q8A031 2-234
  8. 1877826Domain d1wyza1: 1wyz A:2-234 [121471]
    Other proteins in same PDB: d1wyzb_, d1wyzc_, d1wyzd_

Details for d1wyza1

PDB Entry: 1wyz (more details), 2.5 Å

PDB Description: x-ray structure of the putative methyltransferase from bacteroides thetaiotaomicron vpi-5482 at the resolution 2.5 a. norteast structural genomics consortium target btr28
PDB Compounds: (A:) putative S-adenosylmethionine-dependent methyltransferase

SCOPe Domain Sequences for d1wyza1:

Sequence, based on SEQRES records: (download)

>d1wyza1 c.90.1.1 (A:2-234) Putative methytransferase BT4190 {Bacteroides thetaiotaomicron [TaxId: 818]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvgp
ssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkm
iedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk

Sequence, based on observed residues (ATOM records): (download)

>d1wyza1 c.90.1.1 (A:2-234) Putative methytransferase BT4190 {Bacteroides thetaiotaomicron [TaxId: 818]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv
masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn
crpqtklciaanitcegefiqtrtvkdwkghipkipcifllyk

SCOPe Domain Coordinates for d1wyza1:

Click to download the PDB-style file with coordinates for d1wyza1.
(The format of our PDB-style files is described here.)

Timeline for d1wyza1: