SCOPe 2.04: Domain d1wyza1: 1wyz A:2-234

Lineage for d1wyza1 (1wyz A:2-234)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein Putative methytransferase BT4190 [142783] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [142784] (1 PDB entry)
   Uniprot Q8A031 2-234

8. Domain d1wyza1: 1wyz A:2-234 [121471]
   Other proteins in same PDB: d1wyzb_, d1wyzc_, d1wyzd_

Details for d1wyza1

PDB Entry: 1wyz, 2.5 Å

PDB Description: x-ray structure of the putative methyltransferase from bacteroides thetaiotaomicron vpi-5482 at the resolution 2.5 a. norteast structural genomics consortium target btr28

PDB Compounds: (A:) putative S-adenosylmethionine-dependent methyltransferase

SCOPe Domain Sequences for d1wyza1:

Sequence, based on SEQRES records:

>d1wyza1 c.90.1.1 (A:2-234) Putative methytransferase BT4190 {Bacteroides thetaiotaomicron [TaxId: 818]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvgp
ssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkm
iedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk

Sequence, based on observed residues (ATOM records):

>d1wyza1 c.90.1.1 (A:2-234) Putative methytransferase BT4190 {Bacteroides thetaiotaomicron [TaxId: 818]}
etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv
masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn
crpqtklciaanitcegefiqtrtvkdwkghipkipcifllyk

Timeline for d1wyza1:

• d1wyza1 first appeared in SCOP 1.73
  
• d1wyza1 appears in SCOPe 2.03
  
• d1wyza1 appears in SCOPe 2.05
  
• d1wyza1 appears in the current release, SCOPe 2.08