![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
![]() | Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) ![]() |
![]() | Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
![]() | Protein Putative methytransferase BT4190 [142783] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [142784] (1 PDB entry) Uniprot Q8A031 2-234 |
![]() | Domain d1wyza1: 1wyz A:2-234 [121471] Other proteins in same PDB: d1wyzb2, d1wyzb3, d1wyzc2, d1wyzc3, d1wyzd2, d1wyzd3 |
PDB Entry: 1wyz (more details), 2.5 Å
SCOPe Domain Sequences for d1wyza1:
Sequence, based on SEQRES records: (download)
>d1wyza1 c.90.1.1 (A:2-234) Putative methytransferase BT4190 {Bacteroides thetaiotaomicron [TaxId: 818]} etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf yplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvgp ssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkm iedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyk
>d1wyza1 c.90.1.1 (A:2-234) Putative methytransferase BT4190 {Bacteroides thetaiotaomicron [TaxId: 818]} etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn crpqtklciaanitcegefiqtrtvkdwkghipkipcifllyk
Timeline for d1wyza1: