Lineage for d1wyyb1 (1wyy B:892-973,B:1147-1188)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042207Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (2 families) (S)
  5. 3042208Family h.3.3.1: Coronavirus spike glycoprotein S2 fragments [111475] (1 protein)
  6. 3042209Protein E2 spike glycoprotein [111476] (2 species)
  7. 3042210Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)
    Uniprot P59594 896-972,1142-1183
    Uniprot Q6UZF0 914-949,1148-1193
  8. 3042228Domain d1wyyb1: 1wyy B:892-973,B:1147-1188 [121470]
    automated match to d1wyya1
    complexed with cl

Details for d1wyyb1

PDB Entry: 1wyy (more details), 2.2 Å

PDB Description: post-fusion hairpin conformation of the sars coronavirus spike glycoprotein
PDB Compounds: (B:) e2 glycoprotein

SCOPe Domain Sequences for d1wyyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyyb1 h.3.3.1 (B:892-973,B:1147-1188) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
gvtqnvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlssn
fgaissvlndilsrldkveaevXlgdisginasvvniqkeidrlnevaknlneslidlqe
lgkye

SCOPe Domain Coordinates for d1wyyb1:

Click to download the PDB-style file with coordinates for d1wyyb1.
(The format of our PDB-style files is described here.)

Timeline for d1wyyb1: