SCOP 1.75: Domain d1wywb1: 1wyw B:20-97

Lineage for d1wywb1 (1wyw B:20-97)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54242] (14 PDB entries)
   Uniprot Q93068

8. Domain d1wywb1: 1wyw B:20-97 [121468]
   Other proteins in same PDB: d1wywa1
   automatically matched to d1tgzb_
   complexed with cl, mg, na

Details for d1wywb1

PDB Entry: 1wyw, 2.1 Å

PDB Description: Crystal Structure of SUMO1-conjugated thymine DNA glycosylase

PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOP Domain Sequences for d1wywb1:

Sequence; same for both SEQRES and ATOM records:

>d1wywb1 d.15.1.1 (B:20-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

Timeline for d1wywb1:

• d1wywb1 first appeared in SCOP 1.73
  
• d1wywb1 is called d1wywb_ in SCOPe 2.01
  
• d1wywb1 appears in the current release, SCOPe 2.08, called d1wywb_