Lineage for d1wywb_ (1wyw B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein automated matches [190118] (16 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189560] (112 PDB entries)
  8. Domain d1wywb_: 1wyw B: [121468]
    Other proteins in same PDB: d1wywa_
    automated match to d1a5r__
    complexed with cl, mg, na

Details for d1wywb_

PDB Entry: 1wyw (more details), 2.1 Å

PDB Description: Crystal Structure of SUMO1-conjugated thymine DNA glycosylase
PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOPe Domain Sequences for d1wywb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wywb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpk
elgmeeedvievyqeqtgg

SCOPe Domain Coordinates for d1wywb_ are not available.

Timeline for d1wywb_:

Domains from other chains:
(mouse over for more information)
d1wywa_