Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.7: Glycine dehydrogenase subunits (GDC-P) [142678] (2 proteins) Pfam PF02347 |
Protein Glycine dehydrogenase (decarboxylating) subunit 1 [142679] (1 species) |
Species Thermus thermophilus [TaxId:274] [142680] (3 PDB entries) Uniprot Q5SKW8 1-437 |
Domain d1wyvc_: 1wyv C: [121462] Other proteins in same PDB: d1wyvb_, d1wyvd_, d1wyvf_, d1wyvh_ automated match to d1wyta1 complexed with plp |
PDB Entry: 1wyv (more details), 2.4 Å
SCOPe Domain Sequences for d1wyvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wyvc_ c.67.1.7 (C:) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel heeedllalrealkevl
Timeline for d1wyvc_: