Lineage for d1wyvc_ (1wyv C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504266Family c.67.1.7: Glycine dehydrogenase subunits (GDC-P) [142678] (2 proteins)
    Pfam PF02347
  6. 2504267Protein Glycine dehydrogenase (decarboxylating) subunit 1 [142679] (1 species)
  7. 2504268Species Thermus thermophilus [TaxId:274] [142680] (3 PDB entries)
    Uniprot Q5SKW8 1-437
  8. 2504276Domain d1wyvc_: 1wyv C: [121462]
    Other proteins in same PDB: d1wyvb_, d1wyvd_, d1wyvf_, d1wyvh_
    automated match to d1wyta1
    complexed with plp

Details for d1wyvc_

PDB Entry: 1wyv (more details), 2.4 Å

PDB Description: Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in inhibitor-bound form
PDB Compounds: (C:) glycine dehydrogenase (decarboxylating) subunit 1

SCOPe Domain Sequences for d1wyvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyvc_ c.67.1.7 (C:) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]}
mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
heeedllalrealkevl

SCOPe Domain Coordinates for d1wyvc_:

Click to download the PDB-style file with coordinates for d1wyvc_.
(The format of our PDB-style files is described here.)

Timeline for d1wyvc_: