Lineage for d1wytb1 (1wyt B:2-472)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 706155Family c.67.1.7: Glycine dehydrogenase subunits (GDC-P) [142678] (2 proteins)
    Pfam PF02347
  6. 706168Protein Glycine dehydrogenase subunit 2 (P-protein) [142681] (1 species)
  7. 706169Species Thermus thermophilus [TaxId:274] [142682] (3 PDB entries)
  8. 706174Domain d1wytb1: 1wyt B:2-472 [121449]
    Other proteins in same PDB: d1wyta1, d1wytc1

Details for d1wytb1

PDB Entry: 1wyt (more details), 2.4 Å

PDB Description: Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in apo form
PDB Compounds: (B:) glycine dehydrogenase subunit 2 (P-protein)

SCOP Domain Sequences for d1wytb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wytb1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]}
sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfd

SCOP Domain Coordinates for d1wytb1:

Click to download the PDB-style file with coordinates for d1wytb1.
(The format of our PDB-style files is described here.)

Timeline for d1wytb1: