SCOPe 2.08: Domain d1wyta1: 1wyt A:1-437

Lineage for d1wyta1 (1wyt A:1-437)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.7: Glycine dehydrogenase subunits (GDC-P) [142678] (2 proteins)
   Pfam PF02347

6. Protein Glycine dehydrogenase (decarboxylating) subunit 1 [142679] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142680] (3 PDB entries)
   Uniprot Q5SKW8 1-437

8. Domain d1wyta1: 1wyt A:1-437 [121448]
   Other proteins in same PDB: d1wytb1, d1wytd_

Details for d1wyta1

PDB Entry: 1wyt, 2.4 Å

PDB Description: Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in apo form

PDB Compounds: (A:) glycine dehydrogenase (decarboxylating) subunit 1

SCOPe Domain Sequences for d1wyta1:

Sequence; same for both SEQRES and ATOM records:

>d1wyta1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]}
mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
heeedllalrealkevl

Timeline for d1wyta1:

• d1wyta1 first appeared in SCOP 1.73
  
• d1wyta1 appears in SCOPe 2.07