Lineage for d1wyia1 (1wyi A:1-248)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681099Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 681100Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 681101Protein Triosephosphate isomerase [51353] (17 species)
  7. 681170Species Human (Homo sapiens) [TaxId:9606] [51355] (2 PDB entries)
  8. 681171Domain d1wyia1: 1wyi A:1-248 [121446]
    automatically matched to d1htia_

Details for d1wyia1

PDB Entry: 1wyi (more details), 2.2 Å

PDB Description: human triosephosphate isomerase of new crystal form
PDB Compounds: (A:) triosephosphate isomerase

SCOP Domain Sequences for d1wyia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyia1 c.1.1.1 (A:1-248) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
apsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkia
vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeg
lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
vdiinakq

SCOP Domain Coordinates for d1wyia1:

Click to download the PDB-style file with coordinates for d1wyia1.
(The format of our PDB-style files is described here.)

Timeline for d1wyia1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wyib1