Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (5 families) has extra strand located between strands 2 and 3 |
Family c.72.1.1: Ribokinase-like [53614] (9 proteins) |
Protein Hypothetical fructokinase ST2478 [142714] (1 species) |
Species Sulfolobus tokodaii [TaxId:111955] [142715] (2 PDB entries) |
Domain d1wyef1: 1wye F:2-309 [121443] automatically matched to 2DCN A:2-309 |
PDB Entry: 1wye (more details), 2.8 Å
SCOP Domain Sequences for d1wyef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wyef1 c.72.1.1 (F:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd ietflrem
Timeline for d1wyef1: