Lineage for d1wyef1 (1wye F:2-309)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 707937Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 707938Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 707939Family c.72.1.1: Ribokinase-like [53614] (9 proteins)
  6. 707989Protein Hypothetical fructokinase ST2478 [142714] (1 species)
  7. 707990Species Sulfolobus tokodaii [TaxId:111955] [142715] (2 PDB entries)
  8. 708008Domain d1wyef1: 1wye F:2-309 [121443]
    automatically matched to 2DCN A:2-309

Details for d1wyef1

PDB Entry: 1wye (more details), 2.8 Å

PDB Description: crystal structure of 2-keto-3-deoxygluconate kinase (form 1) from sulfolobus tokodaii
PDB Compounds: (F:) 2-keto-3-deoxygluconate kinase

SCOP Domain Sequences for d1wyef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyef1 c.72.1.1 (F:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]}
aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
ietflrem

SCOP Domain Coordinates for d1wyef1:

Click to download the PDB-style file with coordinates for d1wyef1.
(The format of our PDB-style files is described here.)

Timeline for d1wyef1: