SCOPe 2.08: Domain d1wyef_: 1wye F:

Lineage for d1wyef_ (1wye F:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [186841] (2 PDB entries)

8. Domain d1wyef_: 1wye F: [121443]
   automated match to d1v19a_

Details for d1wyef_

PDB Entry: 1wye, 2.8 Å

PDB Description: crystal structure of 2-keto-3-deoxygluconate kinase (form 1) from sulfolobus tokodaii

PDB Compounds: (F:) 2-keto-3-deoxygluconate kinase

SCOPe Domain Sequences for d1wyef_:

Sequence; same for both SEQRES and ATOM records:

>d1wyef_ c.72.1.0 (F:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
ietflremk

Timeline for d1wyef_:

• d1wyef_ first appeared in SCOP 1.73, called d1wyef1
  
• d1wyef_ appears in SCOPe 2.07