Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (50 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [186841] (2 PDB entries) |
Domain d1wyec_: 1wye C: [121440] automated match to d1v19a_ |
PDB Entry: 1wye (more details), 2.8 Å
SCOPe Domain Sequences for d1wyec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wyec_ c.72.1.0 (C:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd ietflremk
Timeline for d1wyec_: