Lineage for d1wyea_ (1wye A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2512071Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2512072Protein automated matches [190117] (50 species)
    not a true protein
  7. 2512390Species Sulfolobus tokodaii [TaxId:273063] [186841] (2 PDB entries)
  8. 2512391Domain d1wyea_: 1wye A: [121438]
    automated match to d1v19a_

Details for d1wyea_

PDB Entry: 1wye (more details), 2.8 Å

PDB Description: crystal structure of 2-keto-3-deoxygluconate kinase (form 1) from sulfolobus tokodaii
PDB Compounds: (A:) 2-keto-3-deoxygluconate kinase

SCOPe Domain Sequences for d1wyea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyea_ c.72.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
ietflremk

SCOPe Domain Coordinates for d1wyea_:

Click to download the PDB-style file with coordinates for d1wyea_.
(The format of our PDB-style files is described here.)

Timeline for d1wyea_: