Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) |
Family c.66.1.32: Ta1320-like [89751] (2 proteins) |
Protein Hypothetical protein PH1948 [142593] (1 species) |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142594] (1 PDB entry) |
Domain d1wy7d1: 1wy7 D:4-204 [121436] automatically matched to 1WY7 A:4-204 complexed with sah |
PDB Entry: 1wy7 (more details), 2.2 Å
SCOP Domain Sequences for d1wy7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wy7d1 c.66.1.32 (D:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} rkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagtgvl sygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnppfg sqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieiplqf ffhrkkleritvdiyrfskvi
Timeline for d1wy7d1: