SCOP 1.73: Domain d1wy7d1: 1wy7 D:4-204

Lineage for d1wy7d1 (1wy7 D:4-204)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.32: Ta1320-like [89751] (2 proteins)

6. Protein Hypothetical protein PH1948 [142593] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142594] (1 PDB entry)

8. Domain d1wy7d1: 1wy7 D:4-204 [121436]
   automatically matched to 1WY7 A:4-204
   complexed with sah

Details for d1wy7d1

PDB Entry: 1wy7, 2.2 Å

PDB Description: crystal structure of a putative RNA methyltransferase PH1948 from Pyrococcus horikoshii

PDB Compounds: (D:) hypothetical protein PH1948

SCOP Domain Sequences for d1wy7d1:

Sequence; same for both SEQRES and ATOM records:

>d1wy7d1 c.66.1.32 (D:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
rkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagtgvl
sygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnppfg
sqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieiplqf
ffhrkkleritvdiyrfskvi

Timeline for d1wy7d1:

• d1wy7d1 is new in SCOP 1.73
  
• d1wy7d1 appears in SCOP 1.75
  
• d1wy7d1 appears in the current release, SCOPe 2.08, called d1wy7d_