SCOP 1.73: Domain d1wy6a1: 1wy6 A:7-167

Lineage for d1wy6a1 (1wy6 A:7-167)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.20: Hypothetical protein ST1625 [101424] (1 family)

5. Family a.118.20.1: Hypothetical protein ST1625 [101425] (1 protein)

6. Protein Hypothetical protein ST1625 [101426] (1 species)

7. Species Archaeon Sulfolobus tokodaii [TaxId:111955] [101427] (1 PDB entry)
   structural genomics

8. Domain d1wy6a1: 1wy6 A:7-167 [121432]
   automatically matched to d1vdua_

Details for d1wy6a1

PDB Entry: 1wy6, 2.2 Å

PDB Description: Crystal Structure of Hypothetical Protein [ST1625p] from Hyperthermophilic Archaeon Sulfolobus tokodaii

PDB Compounds: (A:) hypothetical protein ST1625

SCOP Domain Sequences for d1wy6a1:

Sequence, based on SEQRES records:

>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]}
eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki
gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilknnevsa
silvaianalrrvgderdattllieackkgekeacnavntl

Sequence, based on observed residues (ATOM records):

>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]}
eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki
gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilnevsasi
lvaianalrrvgderdattllieackkgekeacnavntl

Timeline for d1wy6a1:

• d1wy6a1 is new in SCOP 1.73
  
• d1wy6a1 appears in SCOP 1.75
  
• d1wy6a1 appears in the current release, SCOPe 2.08, called d1wy6a_