Lineage for d1wy6a_ (1wy6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007973Superfamily a.118.20: Hypothetical protein ST1625 [101424] (1 family) (S)
    automatically mapped to Pfam PF09205
  5. 2007974Family a.118.20.1: Hypothetical protein ST1625 [101425] (1 protein)
  6. 2007975Protein Hypothetical protein ST1625 [101426] (1 species)
  7. 2007976Species Sulfolobus tokodaii [TaxId:111955] [101427] (1 PDB entry)
    structural genomics
  8. 2007977Domain d1wy6a_: 1wy6 A: [121432]
    automated match to d1vdua_

Details for d1wy6a_

PDB Entry: 1wy6 (more details), 2.2 Å

PDB Description: Crystal Structure of Hypothetical Protein [ST1625p] from Hyperthermophilic Archaeon Sulfolobus tokodaii
PDB Compounds: (A:) hypothetical protein ST1625

SCOPe Domain Sequences for d1wy6a_:

Sequence, based on SEQRES records: (download)

>d1wy6a_ a.118.20.1 (A:) Hypothetical protein ST1625 {Sulfolobus tokodaii [TaxId: 111955]}
eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki
gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilknnevsa
silvaianalrrvgderdattllieackkgekeacnavntl

Sequence, based on observed residues (ATOM records): (download)

>d1wy6a_ a.118.20.1 (A:) Hypothetical protein ST1625 {Sulfolobus tokodaii [TaxId: 111955]}
eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki
gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilnevsasi
lvaianalrrvgderdattllieackkgekeacnavntl

SCOPe Domain Coordinates for d1wy6a_:

Click to download the PDB-style file with coordinates for d1wy6a_.
(The format of our PDB-style files is described here.)

Timeline for d1wy6a_: