SCOPe 2.08: Domain d1wy6a_: 1wy6 A:

Lineage for d1wy6a_ (1wy6 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.20: Hypothetical protein ST1625 [101424] (1 family)
   automatically mapped to Pfam PF09205

5. Family a.118.20.1: Hypothetical protein ST1625 [101425] (1 protein)

6. Protein Hypothetical protein ST1625 [101426] (1 species)

7. Species Sulfolobus tokodaii [TaxId:111955] [101427] (1 PDB entry)
   structural genomics

8. Domain d1wy6a_: 1wy6 A: [121432]
   automated match to d1vdua_

Details for d1wy6a_

PDB Entry: 1wy6, 2.2 Å

PDB Description: Crystal Structure of Hypothetical Protein [ST1625p] from Hyperthermophilic Archaeon Sulfolobus tokodaii

PDB Compounds: (A:) hypothetical protein ST1625

SCOPe Domain Sequences for d1wy6a_:

Sequence, based on SEQRES records:

>d1wy6a_ a.118.20.1 (A:) Hypothetical protein ST1625 {Sulfolobus tokodaii [TaxId: 111955]}
eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki
gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilknnevsa
silvaianalrrvgderdattllieackkgekeacnavntl

Sequence, based on observed residues (ATOM records):

>d1wy6a_ a.118.20.1 (A:) Hypothetical protein ST1625 {Sulfolobus tokodaii [TaxId: 111955]}
eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki
gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilnevsasi
lvaianalrrvgderdattllieackkgekeacnavntl

Timeline for d1wy6a_:

• d1wy6a_ first appeared in SCOP 1.73, called d1wy6a1
  
• d1wy6a_ appears in SCOPe 2.07