Lineage for d1wy5b2 (1wy5 B:217-311)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613871Fold d.229: MesJ substrate recognition domain-like [82828] (1 superfamily)
    beta-alpha(2)-beta(3); 2 layers: a/b; antiparallel beta-sheet, order:1432
  4. 2613872Superfamily d.229.1: MesJ substrate recognition domain-like [82829] (1 family) (S)
  5. 2613873Family d.229.1.1: MesJ substrate recognition domain-like [82830] (2 proteins)
  6. 2613874Protein TilS-like protein Aq_1887 [143132] (1 species)
    lacks the C-terminal domain of the E. coli homologue
  7. 2613875Species Aquifex aeolicus [TaxId:63363] [143133] (3 PDB entries)
    Uniprot O67728 217-311
  8. 2613877Domain d1wy5b2: 1wy5 B:217-311 [121431]
    Other proteins in same PDB: d1wy5a1, d1wy5b1
    automated match to d1wy5a2

Details for d1wy5b2

PDB Entry: 1wy5 (more details), 2.42 Å

PDB Description: Crystal structure of isoluecyl-tRNA lysidine synthetase
PDB Compounds: (B:) Hypothetical UPF0072 protein AQ_1887

SCOPe Domain Sequences for d1wy5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wy5b2 d.229.1.1 (B:217-311) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
enledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig
ekdyekvelvrsllekggevnlgkgkvlkrkerwl

SCOPe Domain Coordinates for d1wy5b2:

Click to download the PDB-style file with coordinates for d1wy5b2.
(The format of our PDB-style files is described here.)

Timeline for d1wy5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wy5b1