Lineage for d1wy5b1 (1wy5 B:1-216)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2119957Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2120207Family c.26.2.5: PP-loop ATPase [82359] (2 proteins)
    automatically mapped to Pfam PF01171
  6. 2120208Protein TilS-like protein Aq_1887 [142087] (1 species)
  7. 2120209Species Aquifex aeolicus [TaxId:63363] [142088] (3 PDB entries)
    Uniprot O67728 1-216
  8. 2120211Domain d1wy5b1: 1wy5 B:1-216 [121430]
    Other proteins in same PDB: d1wy5a2, d1wy5b2
    automated match to d1wy5a1

Details for d1wy5b1

PDB Entry: 1wy5 (more details), 2.42 Å

PDB Description: Crystal structure of isoluecyl-tRNA lysidine synthetase
PDB Compounds: (B:) Hypothetical UPF0072 protein AQ_1887

SCOPe Domain Sequences for d1wy5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wy5b1 c.26.2.5 (B:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
akfkglrwvedetnyevsiprnrirhrvipelkrin

SCOPe Domain Coordinates for d1wy5b1:

Click to download the PDB-style file with coordinates for d1wy5b1.
(The format of our PDB-style files is described here.)

Timeline for d1wy5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wy5b2