Lineage for d1wxya_ (1wxy A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
  6. Protein automated matches [190078] (5 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [186799] (5 PDB entries)
  8. Domain d1wxya_: 1wxy A: [121426]
    automated match to d1w1ie_
    complexed with frk, zn

Details for d1wxya_

PDB Entry: 1wxy (more details), 2.5 Å

PDB Description: crystal structure of adenosine deaminase ligated with a potent inhibitor
PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d1wxya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxya_ c.1.9.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr

SCOPe Domain Coordinates for d1wxya_ are not available.

Timeline for d1wxya_: