SCOP 1.75: Domain d1wxxc1: 1wxx C:1-64

Lineage for d1wxxc1 (1wxx C:1-64)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (13 families)

5. Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
   N-terminal part of Pfam PF03602, structurally similar to PUA domain family

6. Protein Hypothetical protein TTHA1280, N-terminal domain [141717] (1 species)

7. Species Thermus thermophilus [TaxId:274] [141718] (3 PDB entries)
   Uniprot Q5SIT4 1-164

8. Domain d1wxxc1: 1wxx C:1-64 [121422]
   Other proteins in same PDB: d1wxxa2, d1wxxb2, d1wxxc2, d1wxxd2
   automatically matched to 1WXW A:1-64
   complexed with k, po4

Details for d1wxxc1

PDB Entry: 1wxx, 1.8 Å

PDB Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8

PDB Compounds: (C:) hypothetical protein TTHA1280

SCOP Domain Sequences for d1wxxc1:

Sequence; same for both SEQRES and ATOM records:

>d1wxxc1 b.122.1.9 (C:1-64) Hypothetical protein TTHA1280, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
rfap

Timeline for d1wxxc1:

• d1wxxc1 first appeared in SCOP 1.73
  
• d1wxxc1 appears in SCOPe 2.01
  
• d1wxxc1 appears in the current release, SCOPe 2.08