Lineage for d1wxwd1 (1wxw D:1-64)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824027Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
    N-terminal part of Pfam PF03602, structurally similar to PUA domain family
  6. 2824036Protein Hypothetical protein TTHA1280, N-terminal domain [141717] (1 species)
  7. 2824037Species Thermus thermophilus [TaxId:274] [141718] (3 PDB entries)
    Uniprot Q5SIT4 1-164
  8. 2824045Domain d1wxwd1: 1wxw D:1-64 [121416]
    Other proteins in same PDB: d1wxwa2, d1wxwb2, d1wxwc2, d1wxwd2
    automated match to d1wxwa1
    complexed with hez

Details for d1wxwd1

PDB Entry: 1wxw (more details), 2.55 Å

PDB Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8
PDB Compounds: (D:) hypothetical protein TTHA1280

SCOPe Domain Sequences for d1wxwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxwd1 b.122.1.9 (D:1-64) Hypothetical protein TTHA1280, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
rfap

SCOPe Domain Coordinates for d1wxwd1:

Click to download the PDB-style file with coordinates for d1wxwd1.
(The format of our PDB-style files is described here.)

Timeline for d1wxwd1: