Lineage for d1wxwa2 (1wxw A:65-382)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130452Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 protein domains)
    C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam PF05958)
  6. 2130461Protein Hypothetical protein TTHA1280, middle and C-terminal domains [142638] (1 species)
  7. 2130462Species Thermus thermophilus [TaxId:274] [142639] (3 PDB entries)
    Uniprot Q5SIT4 65-382
  8. 2130467Domain d1wxwa2: 1wxw A:65-382 [121411]
    Other proteins in same PDB: d1wxwa1, d1wxwb1, d1wxwc1, d1wxwd1
    complexed with hez

Details for d1wxwa2

PDB Entry: 1wxw (more details), 2.55 Å

PDB Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8
PDB Compounds: (A:) hypothetical protein TTHA1280

SCOPe Domain Sequences for d1wxwa2:

Sequence, based on SEQRES records: (download)

>d1wxwa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}
aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah
awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv
dlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaeal
rraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayray
kevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpv
llnhpethylkfavfqvl

Sequence, based on observed residues (ATOM records): (download)

>d1wxwa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}
aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah
awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv
dlraayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaealrraee
narlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayraykevnl
raikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpvllnhp
ethylkfavfqvl

SCOPe Domain Coordinates for d1wxwa2:

Click to download the PDB-style file with coordinates for d1wxwa2.
(The format of our PDB-style files is described here.)

Timeline for d1wxwa2: