Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Bag-family molecular chaperone regulator-1 [142932] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142933] (1 PDB entry) Uniprot Q99933 72-152 the BAG domain structure is also known (63494) |
Domain d1wxva1: 1wxv A:7-87 [121409] |
PDB Entry: 1wxv (more details)
SCOPe Domain Sequences for d1wxva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} gltvtvthsnekhdlhvtsqqgssepvvqdlaqvveevigvpqsfqklifkgkslkemet plsalgiqdgcrvmligkkns
Timeline for d1wxva1: