Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.6: BM-002-like [75362] (3 proteins) Pfam PF03671; UPF0185; this family comprises small uncharacterized proteins including human protein BM-002 |
Protein Ubiquitin-fold modifier 1 [142970] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142971] (1 PDB entry) Uniprot P61960 1-83 |
Domain d1wxsa1: 1wxs A:1-83 [121408] Other proteins in same PDB: d1wxsa2 |
PDB Entry: 1wxs (more details)
SCOPe Domain Sequences for d1wxsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wxsa1 d.15.1.6 (A:1-83) Ubiquitin-fold modifier 1 {Human (Homo sapiens) [TaxId: 9606]} mskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgiginpa qtagnvflkhgselriiprdrvg
Timeline for d1wxsa1: