Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (2 families) possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
Family d.15.10.2: G domain-linked domain [82583] (2 proteins) |
Protein GTP-binding protein PH0525 [142980] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [142981] (1 PDB entry) Uniprot O58261 320-395 |
Domain d1wxqa2: 1wxq A:320-395 [121407] Other proteins in same PDB: d1wxqa1 |
PDB Entry: 1wxq (more details), 2.6 Å
SCOP Domain Sequences for d1wxqa2:
Sequence, based on SEQRES records: (download)
>d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} ipvypvhdenkltdqfgnvlphvflmkkgstprdlafkvhtdlgkgflyainartkrrvg edyelqfndivkivsv
>d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} ipvypvhdeqfgnvlphvflmkkgstprdlafkvhtdlgkgflyainartkrrvgedyel qfndivkivsv
Timeline for d1wxqa2: