SCOPe 2.08: Domain d1wxqa2: 1wxq A:320-395

Lineage for d1wxqa2 (1wxq A:320-395)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.10: TGS-like [81271] (3 families)
   possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif

5. Family d.15.10.2: G domain-linked domain [82583] (2 proteins)

6. Protein GTP-binding protein PH0525 [142980] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [142981] (1 PDB entry)
   Uniprot O58261 320-395

8. Domain d1wxqa2: 1wxq A:320-395 [121407]
   Other proteins in same PDB: d1wxqa1

Details for d1wxqa2

PDB Entry: 1wxq, 2.6 Å

PDB Description: Crystal Structure of GTP binding protein from Pyrococcus horikoshii OT3

PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d1wxqa2:

Sequence, based on SEQRES records:

>d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]}
ipvypvhdenkltdqfgnvlphvflmkkgstprdlafkvhtdlgkgflyainartkrrvg
edyelqfndivkivsv

Sequence, based on observed residues (ATOM records):

>d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]}
ipvypvhdeqfgnvlphvflmkkgstprdlafkvhtdlgkgflyainartkrrvgedyel
qfndivkivsv

Timeline for d1wxqa2:

• d1wxqa2 first appeared in SCOP 1.73
  
• d1wxqa2 appears in SCOPe 2.07