Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein GTP-binding protein PH0525 [142251] (1 species) Member of the Obg family of GTPases; contains an alpha-hairpin insert subdomain |
Species Pyrococcus horikoshii [TaxId:53953] [142252] (1 PDB entry) |
Domain d1wxqa1: 1wxq A:1-319 [121406] Other proteins in same PDB: d1wxqa2 |
PDB Entry: 1wxq (more details), 2.6 Å
SCOP Domain Sequences for d1wxqa1:
Sequence, based on SEQRES records: (download)
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} meigvvgkpnvgkstffsaatlvdveianypfttieanvgvtyaitdhpckelgcspnpq nyeyrnglalipvkmvdvaglvpgahegrglgnkflddlrmasalihvvdatgktdpegq ptdyhdpvedieflereidywiygilskgwdkfakriklqkiklesaiaehlsgigvnen dvweamhklnlpedptkwsqddllafaseirrvnkpmviaankadaasdeqikrlvreee krgyiviptsaaaeltlrkaakagfieyipgasefkvlrdmsekqkralmvikekvldrf gstgvqevinrvvfdllkl
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} meigvvgkpnvgkstffsaatlanvgvtyaitdhpckelgcspnpqnyeyrnglalipvk mvdvaflddlrmasalihvvdatgktdpegqptdyhdpvedieflereidywiygilskg wdkfakriklqkiklesaiaehlsgigvnendvweamhklnlpedptkwsqddllafase irrvnkpmviaankadaasdeqikrlvreeekrgyiviptsaaaeltlrkaakagfieyi palmvikekvldrfgstgvqevinrvvfdllkl
Timeline for d1wxqa1: