Lineage for d1wxqa1 (1wxq A:1-319)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110513Protein GTP-binding protein PH0525 [142251] (1 species)
    Member of the Obg family of GTPases; contains an alpha-hairpin insert subdomain
  7. 2110514Species Pyrococcus horikoshii [TaxId:53953] [142252] (1 PDB entry)
    Uniprot O58261 1-319
  8. 2110515Domain d1wxqa1: 1wxq A:1-319 [121406]
    Other proteins in same PDB: d1wxqa2

Details for d1wxqa1

PDB Entry: 1wxq (more details), 2.6 Å

PDB Description: Crystal Structure of GTP binding protein from Pyrococcus horikoshii OT3
PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d1wxqa1:

Sequence, based on SEQRES records: (download)

>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]}
meigvvgkpnvgkstffsaatlvdveianypfttieanvgvtyaitdhpckelgcspnpq
nyeyrnglalipvkmvdvaglvpgahegrglgnkflddlrmasalihvvdatgktdpegq
ptdyhdpvedieflereidywiygilskgwdkfakriklqkiklesaiaehlsgigvnen
dvweamhklnlpedptkwsqddllafaseirrvnkpmviaankadaasdeqikrlvreee
krgyiviptsaaaeltlrkaakagfieyipgasefkvlrdmsekqkralmvikekvldrf
gstgvqevinrvvfdllkl

Sequence, based on observed residues (ATOM records): (download)

>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]}
meigvvgkpnvgkstffsaatlanvgvtyaitdhpckelgcspnpqnyeyrnglalipvk
mvdvaflddlrmasalihvvdatgktdpegqptdyhdpvedieflereidywiygilskg
wdkfakriklqkiklesaiaehlsgigvnendvweamhklnlpedptkwsqddllafase
irrvnkpmviaankadaasdeqikrlvreeekrgyiviptsaaaeltlrkaakagfieyi
palmvikekvldrfgstgvqevinrvvfdllkl

SCOPe Domain Coordinates for d1wxqa1:

Click to download the PDB-style file with coordinates for d1wxqa1.
(The format of our PDB-style files is described here.)

Timeline for d1wxqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wxqa2