SCOPe 2.07: Domain d1wxoa_: 1wxo A:

Lineage for d1wxoa_ (1wxo A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families)
   putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)

5. Family d.67.1.2: AlaX-like [103051] (3 proteins)

6. Protein Hypothetical protein PH0574 [103052] (1 species)
   stand-alone protein related to the AlaRS domain

7. Species Pyrococcus horikoshii [TaxId:53953] [103053] (4 PDB entries)
   Uniprot P27248

8. Domain d1wxoa_: 1wxo A: [121403]
   automated match to d1v4pa_
   complexed with zn

Details for d1wxoa_

PDB Entry: 1wxo, 1.88 Å

PDB Description: Structure of Archaeal Trans-Editing Protein AlaX in complex with zinc

PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1wxoa_:

Sequence; same for both SEQRES and ATOM records:

>d1wxoa_ d.67.1.2 (A:) Hypothetical protein PH0574 {Pyrococcus horikoshii [TaxId: 53953]}
mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
tkttgeigpikirkvrfrkskglleihfelle

Timeline for d1wxoa_:

• d1wxoa_ first appeared in SCOP 1.73, called d1wxoa1
  
• d1wxoa_ appears in SCOPe 2.06
  
• d1wxoa_ appears in the current release, SCOPe 2.08