Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2) |
Family d.67.1.2: AlaX-like [103051] (3 proteins) |
Protein Hypothetical protein PH0574 [103052] (1 species) stand-alone protein related to the AlaRS domain |
Species Pyrococcus horikoshii [TaxId:53953] [103053] (4 PDB entries) Uniprot P27248 |
Domain d1wxoa_: 1wxo A: [121403] automated match to d1v4pa_ complexed with zn |
PDB Entry: 1wxo (more details), 1.88 Å
SCOPe Domain Sequences for d1wxoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wxoa_ d.67.1.2 (A:) Hypothetical protein PH0574 {Pyrococcus horikoshii [TaxId: 53953]} mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh tkttgeigpikirkvrfrkskglleihfelle
Timeline for d1wxoa_: