![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
![]() | Protein automated matches [190053] (10 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [186840] (1 PDB entry) |
![]() | Domain d1wxja_: 1wxj A: [121401] automated match to d1ujpa_ complexed with ipl, so4 |
PDB Entry: 1wxj (more details), 1.7 Å
SCOPe Domain Sequences for d1wxja_:
Sequence, based on SEQRES records: (download)
>d1wxja_ c.1.2.4 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysdplgdgp viqraselalrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqaga tgvilpdlppdedpglvrlaqeigletvfllaptstdariatvvrhatgfvyavsvtgvt gmrerlpeevkdlvrrikartalpvavgfgvsgkataaqaavadgvvvgsalvraleegr slapllqeirqglqrle
>d1wxja_ c.1.2.4 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysgpviqra selalrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqagatgvil pdlppdedpglvrlaqeigletvfllaptstdariatvvrhatgfvyavsevkdlvrrik artalpvavgfgvsgkataaqaavadgvvvgsalvraleegrslapllqeirqglqrle
Timeline for d1wxja_: