Lineage for d1wxja_ (1wxj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079697Protein automated matches [190053] (9 species)
    not a true protein
  7. 2079738Species Thermus thermophilus HB8 [TaxId:300852] [186840] (1 PDB entry)
  8. 2079739Domain d1wxja_: 1wxj A: [121401]
    automated match to d1ujpa_
    complexed with ipl, so4

Details for d1wxja_

PDB Entry: 1wxj (more details), 1.7 Å

PDB Description: Crystal Structure Of Tryptophan Synthase A-Subunit with Indole-3-propanol phosphate From Thermus Thermophilus Hb8
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d1wxja_:

Sequence, based on SEQRES records: (download)

>d1wxja_ c.1.2.4 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysdplgdgp
viqraselalrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqaga
tgvilpdlppdedpglvrlaqeigletvfllaptstdariatvvrhatgfvyavsvtgvt
gmrerlpeevkdlvrrikartalpvavgfgvsgkataaqaavadgvvvgsalvraleegr
slapllqeirqglqrle

Sequence, based on observed residues (ATOM records): (download)

>d1wxja_ c.1.2.4 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysgpviqra
selalrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqagatgvil
pdlppdedpglvrlaqeigletvfllaptstdariatvvrhatgfvyavsevkdlvrrik
artalpvavgfgvsgkataaqaavadgvvvgsalvraleegrslapllqeirqglqrle

SCOPe Domain Coordinates for d1wxja_:

Click to download the PDB-style file with coordinates for d1wxja_.
(The format of our PDB-style files is described here.)

Timeline for d1wxja_: