Lineage for d1wxia_ (1wxi A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842519Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1842520Protein automated matches [190116] (18 species)
    not a true protein
  7. 1842547Species Escherichia coli [TaxId:562] [186839] (4 PDB entries)
  8. 1842548Domain d1wxia_: 1wxi A: [121400]
    automated match to d1ee1a_
    complexed with amp, dpo, mg

Details for d1wxia_

PDB Entry: 1wxi (more details), 1.7 Å

PDB Description: E.coli NAD Synthetase, AMP.PP
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1wxia_:

Sequence, based on SEQRES records: (download)

>d1wxia_ c.26.2.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq
mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa
lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi
nplyrlnkrqgkqllaalacpehlykkaptadleddrpslpdevalgvtydniddylegk
nvpqqvartienwylktehkrrppitvfddfwkk

Sequence, based on observed residues (ATOM records): (download)

>d1wxia_ c.26.2.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq
mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa
lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi
nplyrlnkrqgkqllaalacpehlykkadevalgvtydniddylegknvpqqvartienw
ylktehkrrppitvfddfwkk

SCOPe Domain Coordinates for d1wxia_:

Click to download the PDB-style file with coordinates for d1wxia_.
(The format of our PDB-style files is described here.)

Timeline for d1wxia_: