![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
![]() | Protein automated matches [190116] (28 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [186839] (4 PDB entries) |
![]() | Domain d1wxia_: 1wxi A: [121400] automated match to d1ee1a_ complexed with amp, dpo, mg |
PDB Entry: 1wxi (more details), 1.7 Å
SCOPe Domain Sequences for d1wxia_:
Sequence, based on SEQRES records: (download)
>d1wxia_ c.26.2.0 (A:) automated matches {Escherichia coli [TaxId: 562]} tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi nplyrlnkrqgkqllaalacpehlykkaptadleddrpslpdevalgvtydniddylegk nvpqqvartienwylktehkrrppitvfddfwkk
>d1wxia_ c.26.2.0 (A:) automated matches {Escherichia coli [TaxId: 562]} tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi nplyrlnkrqgkqllaalacpehlykkadevalgvtydniddylegknvpqqvartienw ylktehkrrppitvfddfwkk
Timeline for d1wxia_: