Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (7 proteins) |
Protein NH3-dependent NAD+-synthetase [52406] (3 species) |
Species Escherichia coli [TaxId:562] [142083] (5 PDB entries) |
Domain d1wxha1: 1wxh A:2-275 [121399] automatically matched to 1WXE A:2-275 complexed with nad |
PDB Entry: 1wxh (more details), 1.9 Å
SCOP Domain Sequences for d1wxha1:
Sequence, based on SEQRES records: (download)
>d1wxha1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]} tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi nplyrlnkrqgkqllaalacpehlykkaptadleddrpslpdevalgvtydniddylegk nvpqqvartienwylktehkrrppitvfddfwkk
>d1wxha1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]} tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq mainelrletgneslqfiavrlpygveqdcqdaiafiqpdrvltvnikgavlaseqalre agielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdinpl yrlnkrqgkqllaalacpehlykevalgvtydniddylegknvpqqvartienwylkteh krrppitvfddfwkk
Timeline for d1wxha1: