SCOPe 2.04: Domain d1wxfa_: 1wxf A:

Lineage for d1wxfa_ (1wxf A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186839] (4 PDB entries)

8. Domain d1wxfa_: 1wxf A: [121397]
   automated match to d1ee1a_

Details for d1wxfa_

PDB Entry: 1wxf, 2.3 Å

PDB Description: E.coli NAD Synthetase

PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1wxfa_:

Sequence, based on SEQRES records:

>d1wxfa_ c.26.2.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq
mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa
lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi
nplyrlnkrqgkqllaalacpehlykkaptadleddrpslpdevalgvtydniddylegk
nvpqqvartienwylktehkrrppitvfddfwkk

Sequence, based on observed residues (ATOM records):

>d1wxfa_ c.26.2.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq
mainelrletgneslqfiavrlpygveqdcqdaiafiqpdrvltvnikgavlaseqalre
agielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdinpl
yrlnkrqgkqllaalacpehlykevalgvtydniddylegknvpqqvartienwylkteh
krrppitvfddfwkk

Timeline for d1wxfa_:

• d1wxfa_ first appeared in SCOP 1.73, called d1wxfa1
  
• d1wxfa_ appears in SCOPe 2.03
  
• d1wxfa_ appears in SCOPe 2.05
  
• d1wxfa_ appears in the current release, SCOPe 2.08