SCOPe 2.04: Domain d1wxea1: 1wxe A:2-275

Lineage for d1wxea1 (1wxe A:2-275)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein NH3-dependent NAD+-synthetase [52406] (4 species)

7. Species Escherichia coli [TaxId:562] [142083] (1 PDB entry)
   Uniprot P18843 2-275

8. Domain d1wxea1: 1wxe A:2-275 [121396]
   complexed with amp, mg

Details for d1wxea1

PDB Entry: 1wxe, 1.9 Å

PDB Description: E.coli NAD Synthetase, AMP

PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1wxea1:

Sequence, based on SEQRES records:

>d1wxea1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]}
tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq
mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa
lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi
nplyrlnkrqgkqllaalacpehlykkaptadleddrpslpdevalgvtydniddylegk
nvpqqvartienwylktehkrrppitvfddfwkk

Sequence, based on observed residues (ATOM records):

>d1wxea1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]}
tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq
mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa
lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi
nplyrlnkrqgkqllaalacpehlykevalgvtydniddylegknvpqqvartienwylk
tehkrrppitvfddfwkk

Timeline for d1wxea1:

• d1wxea1 first appeared in SCOP 1.73
  
• d1wxea1 appears in SCOPe 2.03
  
• d1wxea1 appears in SCOPe 2.05
  
• d1wxea1 appears in the current release, SCOPe 2.08