Lineage for d1wxea1 (1wxe A:2-275)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861350Protein NH3-dependent NAD+-synthetase [52406] (4 species)
  7. 2861375Species Escherichia coli [TaxId:562] [142083] (1 PDB entry)
    Uniprot P18843 2-275
  8. 2861376Domain d1wxea1: 1wxe A:2-275 [121396]
    complexed with amp, mg
    has additional insertions and/or extensions that are not grouped together

Details for d1wxea1

PDB Entry: 1wxe (more details), 1.9 Å

PDB Description: E.coli NAD Synthetase, AMP
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1wxea1:

Sequence, based on SEQRES records: (download)

>d1wxea1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]}
tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq
mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa
lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi
nplyrlnkrqgkqllaalacpehlykkaptadleddrpslpdevalgvtydniddylegk
nvpqqvartienwylktehkrrppitvfddfwkk

Sequence, based on observed residues (ATOM records): (download)

>d1wxea1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]}
tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq
mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa
lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi
nplyrlnkrqgkqllaalacpehlykevalgvtydniddylegknvpqqvartienwylk
tehkrrppitvfddfwkk

SCOPe Domain Coordinates for d1wxea1:

Click to download the PDB-style file with coordinates for d1wxea1.
(The format of our PDB-style files is described here.)

Timeline for d1wxea1: