Lineage for d1wxaa1 (1wxa A:8-110)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178530Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2178534Protein Afadin [142964] (1 species)
  7. 2178535Species Mouse (Mus musculus) [TaxId:10090] [142965] (1 PDB entry)
    Uniprot Q9QZQ1 246-348
    The FHA domain structure is also known (PDB 1wln)
  8. 2178536Domain d1wxaa1: 1wxa A:8-110 [121395]
    Other proteins in same PDB: d1wxaa2, d1wxaa3

Details for d1wxaa1

PDB Entry: 1wxa (more details)

PDB Description: solution structure of ras-binding domain in mouse af-6 protein
PDB Compounds: (A:) Afadin

SCOPe Domain Sequences for d1wxaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxaa1 d.15.1.5 (A:8-110) Afadin {Mouse (Mus musculus) [TaxId: 10090]}
sggtlriyadslkpnipyktillsttdtadfavaeslekyglekenpkdyciarvmlppg
aqhsdergakeiildddecplqifrewpsdkgilvfqlkrrpp

SCOPe Domain Coordinates for d1wxaa1:

Click to download the PDB-style file with coordinates for d1wxaa1.
(The format of our PDB-style files is described here.)

Timeline for d1wxaa1: